Structure of PDB 1uvt Chain H Binding Site BS01

Receptor Information
>1uvt Chain H (length=247) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETVQP
SVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGG
PFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIKVID
Ligand information
>1uvt Chain L (length=25) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CGLRPLFEKKQVQDQTEKELFESYI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uvt Enzyme flexibility, solvent and 'weak' interactions characterize thrombin-ligand interactions: implications for drug design.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E23 G25 L26 P28 W29 D116 H119 P120 C122 F134 K135 R137 N159 K202 P204 N205 R206 W207
Binding residue
(residue number reindexed from 1)		E8 G10 L11 P13 W14 D113 H116 P117 C119 F134 K135 R137 N157 K205 P207 N210 R211 W212
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1uvt, PDBe:1uvt, PDBj:1uvt
PDBsum1uvt
PubMed8939759
UniProtP00735|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]