Structure of PDB 1u3h Chain H Binding Site BS01

Receptor Information

>1u3h Chain H (length=189) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAV
TELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVI
SLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNG
DWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA

Ligand information

>1u3h Chain I (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRGGASQYRPSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1u3h Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
Resolution	2.42 Å
Binding residue (original residue number in PDB)	F11 P13 Y26 Y30 D57 Y61 Y67 E74 Y81 N82
Binding residue (residue number reindexed from 1)	F11 P13 Y26 Y30 D57 Y61 Y65 E72 Y79 N80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1u3h, PDBe:1u3h, PDBj:1u3h
PDBsum	1u3h
PubMed	15664161
UniProt	P06344\|HB2U_MOUSE H-2 class II histocompatibility antigen, A-U beta chain

[Back to BioLiP]