Structure of PDB 1tet Chain H Binding Site BS01

Receptor Information
>1tet Chain H (length=209) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKTPGETVRISCKASGYTFTTYGMSWVKQTPGKGFKWMGW
INTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARRS
WYFDVWGTGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASST
KVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tet Crystal structure of an anticholera toxin peptide complex at 2.3 A.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T30 T31 Y32 G33 W50 N52 T52A R95 S96 W100A
Binding residue
(residue number reindexed from 1)		T30 T31 Y32 G33 W50 N52 T53 R99 S100 W101
External links