Structure of PDB 1s03 Chain H Binding Site BS01

Receptor Information

>1s03 Chain H (length=127) Species: 562 (Escherichia coli)

QDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEG
DTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAV
VSTSKGVMTDRAARQAGLGGEIICYVA

Ligand information

>1s03 Chain A (length=47)

ggacgauggcgaaacugcaugaggcaauucaugcaagucccucgucc

<<<<<<.<<.<<..<<<<<<<<......>>>>>>.>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1s03 The structure of a ribosomal protein S8/spc operon mRNA complex.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): P27 S29 K30 R83 Y85 K86 R87 K88 S104 T105 S106 K107 G119 G121
• Binding residue (residue number reindexed from 1): P25 S27 K28 R81 Y83 K84 R85 K86 S102 T103 S104 K105 G117 G119
• Binding affinity: PDBbind-CN: Kd=0.2uM

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0043488 regulation of mRNA stability

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1s03, PDBe:1s03, PDBj:1s03
• PDBsum: 1s03
• PubMed: 15146079
• UniProt: P0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)