Structure of PDB 1r5i Chain H Binding Site BS01

Receptor Information
>1r5i Chain H (length=214) Species: 2111 (Metamycoplasma arthritidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFK
LKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQ
IKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQ
KLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIE
LKTTSDFAKAVFED
Ligand information
>1r5i Chain G (length=13) Species: 384484 (Influenza A virus (A/swine/Hong Kong/81/1978(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r5i Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
Q12 H14 F15 N18 L19
Binding residue
(residue number reindexed from 1)
Q13 H15 F16 N19 L20
Enzymatic activity
Enzyme Commision number ?
External links