Structure of PDB 1qnz Chain H Binding Site BS01

Receptor Information
>1qnz Chain H (length=119) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGAELVKPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGN
FHPYSDDTNYNEKFKGKAKLTVEKSSSTVYLEFSRLTSDDSAVYYCAIHY
GSAYAMDYWGQGTSVTVSS
Ligand information
>1qnz Chain P (length=18) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKSIRIQRGPGRAFVTIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qnz NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding
ResolutionN/A
Binding residue
(original residue number in PDB)		T143 Y144 P145 N162 F163 H164 Y166 D169 T170 N171 I210 H211 A215
Binding residue
(residue number reindexed from 1)		T31 Y32 P33 N50 F51 H52 Y54 D57 T58 N59 I98 H99 A103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0016064 immunoglobulin mediated immune response
Cellular Component
GO:0019814 immunoglobulin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qnz, PDBe:1qnz, PDBj:1qnz
PDBsum1qnz
PubMed10801487
UniProtP01750|HVM06_MOUSE Ig heavy chain V region 102

[Back to BioLiP]