Structure of PDB 1qkz Chain H Binding Site BS01

Receptor Information
>1qkz Chain H (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVKLVESGGGLVKPGRSLKLSCAASGFTFSDYYMFWVRQTPEQRLEWVAT
ISDGGAYTYYPDSVKGRFTISRDNAKNNLYLQMNSLKSEDTGMYYCARDP
LEYYGMDYWGQGTSVAVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKG
YFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVNVTSSTWPSQSIT
CNVAHPASSTKVDKKIVPR
Ligand information
>1qkz Chain P (length=10) Species: 487 (Neisseria meningitidis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANGGASGQVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qkz Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Y33 F35 T50 Y58 D95 L97 Y100
Binding residue
(residue number reindexed from 1)		Y33 F35 T50 Y59 D99 L101 Y104
External links