Structure of PDB 1qiy Chain H Binding Site BS01

Receptor Information
>1qiy Chain H (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQYLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1qiy Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qiy Structural Consequences of the B5 Histidine --> Tyrosine Mutation in Human Insulin Characterized by X-Ray Crystallography and Conformational Analysis.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		C7 L11 L15 V18 C19 R22 G23 F25 T30
Binding residue
(residue number reindexed from 1)		C7 L11 L15 V18 C19 R22 G23 F25 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1qiy, PDBe:1qiy, PDBj:1qiy
PDBsum1qiy
PubMed10508408
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]