Structure of PDB 1p4b Chain H Binding Site BS01

Receptor Information
>1p4b Chain H (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGV
IWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLF
DYWGQGTTLTVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p4b Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		Y39 W59 G109 L110 D137
Binding residue
(residue number reindexed from 1)		Y32 W52 G98 L99 D101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0016064 immunoglobulin mediated immune response
Cellular Component
GO:0019814 immunoglobulin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p4b, PDBe:1p4b, PDBj:1p4b
PDBsum1p4b
PubMed14754898
UniProtP01820|HVM44_MOUSE Ig heavy chain V region PJ14

[Back to BioLiP]