Structure of PDB 1p3p Chain H Binding Site BS01

Receptor Information
>1p3p Chain H (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>1p3p Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p3p Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K1428 R1430 K1431 S1433 I1436
Binding residue
(residue number reindexed from 1)		K2 R4 K5 S7 I10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3p, PDBe:1p3p, PDBj:1p3p
PDBsum1p3p
PubMed14739929
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]