Structure of PDB 1o9k Chain H Binding Site BS01

Receptor Information
>1o9k Chain H (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYE
LMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVL
IKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1o9k Crystal Structure of the Retinoblastoma Tumor Suppressor Protein Bound to E2F and the Molecular Basis of its Regulation
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T645 S646 L649 K652 K653 R656
Binding residue
(residue number reindexed from 1)		T2 S3 L6 K9 K10 R13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1o9k, PDBe:1o9k, PDBj:1o9k
PDBsum1o9k
PubMed12598654
UniProtP06400|RB_HUMAN Retinoblastoma-associated protein (Gene Name=RB1)

[Back to BioLiP]