Structure of PDB 1n64 Chain H Binding Site BS01

Receptor Information
>1n64 Chain H (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGW
VNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFL
LRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGY
FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTC
NVAHPASSTKVDKKIVPR
Ligand information
>1n64 Chain P (length=16) Species: 31645 (Hepatitis C virus (isolate Taiwan)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGGGQIVGGVYLLPRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n64 Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		D31 F32 S33 W50 N52 T52A E53 L97 Q99
Binding residue
(residue number reindexed from 1)		D31 F32 S33 W50 N52 T53 E54 L101 Q103
External links