Structure of PDB 1kq2 Chain H Binding Site BS01

Receptor Information
>1kq2 Chain H (length=62) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHL
IYKHAISTYTVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kq2 Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		Q8 K41 Y42 K57 H58
Binding residue
(residue number reindexed from 1)		Q4 K37 Y38 K53 H54
Binding affinityPDBbind-CN: Kd=30.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kq2, PDBe:1kq2, PDBj:1kq2
PDBsum1kq2
PubMed12093755
UniProtA0A0H3JV59

[Back to BioLiP]