Structure of PDB 1keg Chain H Binding Site BS01

Receptor Information

>1keg Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLQQSGTVLARPGASVKMSCKASGYSFTSFWMHWVKQRPGQGLEWIGT
IYPGNSDTSYNQKFKGKAKLTAVTSASTAYMEVSSLTNEDSAVYYCTRRS
GYKYYALDYWGQGTSVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFP
EPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNV
AHPASSTKVDKKIEPR

Ligand information

>1keg Chain A (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1keg Structure of the DNA (6-4) photoproduct dTT(6-4)TT in complex with the 64M-2 antibody Fab fragment implies increased antibody-binding affinity by the flanking nucleotides.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	W33 H35 S58 R95 S96 Y100I
Binding residue (residue number reindexed from 1)	W33 H35 S59 R99 S100 Y105

External links

PDB	RCSB:1keg, PDBe:1keg, PDBj:1keg
PDBsum	1keg
PubMed	22349224

[Back to BioLiP]