Structure of PDB 1jbu Chain H Binding Site BS01

Receptor Information
>1jbu Chain H (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIA
VLGEHDHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVV
PLCLPERTFSERTLAFVRFSLVSGWTALELMVLNVPRLMTQDCLQQSRKV
GDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGQG
CATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP
Ligand information
>1jbu Chain X (length=15) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEWEVLCWTWETCER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jbu The factor VII zymogen structure reveals reregistration of beta strands during activation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F59 D60 I60B W61 L64 V88 I89 K240 L241 R247 G249 V250 L251 L252 R253 A254 P255
Binding residue
(residue number reindexed from 1)		F39 D40 I42 W45 L48 V69 I70 K222 L223 R229 G231 V232 L233 L234 R235 A236 P237
Enzymatic activity
Enzyme Commision number 3.4.21.21: coagulation factor VIIa.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jbu, PDBe:1jbu, PDBj:1jbu
PDBsum1jbu
PubMed11470437
UniProtP08709|FA7_HUMAN Coagulation factor VII (Gene Name=F7)

[Back to BioLiP]