Structure of PDB 1ikf Chain H Binding Site BS01

Receptor Information
>1ikf Chain H (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLVESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQNSEKRLEWVAF
ISNGGGSAFYADIVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCTRHT
LYDTLYGNYPVWFADWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVT
LGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSS
RPSETVTCNVAHPASSTKVDKKIVPRDC
Ligand information
>1ikf Chain C (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ikf A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y33 N53 H99 L101 G107 N108 Y109 P110
Binding residue
(residue number reindexed from 1)		Y33 N53 H99 L101 G107 N108 Y109 P110
External links