Structure of PDB 1hin Chain H Binding Site BS01

Receptor Information

>1hin Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVAT
ISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRE
RYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVK
GYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSI
TCNVAHPASSTKVDKKIEPR

Ligand information

>1hin Chain P (length=8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YDVPDYAS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1hin Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	S52 N52A G53 G54 Y56 Y58 R95 E96 R97 E100 G100B
Binding residue (residue number reindexed from 1)	S52 N53 G54 G55 Y57 Y59 R99 E100 R101 E104 G106

External links

PDB	RCSB:1hin, PDBe:1hin, PDBj:1hin
PDBsum	1hin
PubMed	1546293

[Back to BioLiP]