Structure of PDB 1fnx Chain H Binding Site BS01

Receptor Information
>1fnx Chain H (length=174) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGF
VNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPK
TMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIK
GLNGQKPLGAAEPITVKFANNPSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fnx Solution structure of mouse HuC RNA-binding domains complexed with an AU-Rich element reveals determinants of neuronal differentiation
ResolutionN/A
Binding residue
(original residue number in PDB)		N40 I42 N44 Y45 Q48 K69 V71 K74 Q78 S79 L80 Y82 F84 K108 T109 K111 S113 R116 R123 D124 N126 Y128 R155 L157 R166 V168 F170 R172 A203 N204
Binding residue
(residue number reindexed from 1)		N6 I8 N10 Y11 Q14 K35 V37 K40 Q44 S45 L46 Y48 F50 K74 T75 K77 S79 R82 R89 D90 N92 Y94 R121 L123 R132 V134 F136 R138 A169 N170
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1fnx, PDBe:1fnx, PDBj:1fnx
PDBsum1fnx
PubMed
UniProtQ60900|ELAV3_MOUSE ELAV-like protein 3 (Gene Name=Elavl3)

[Back to BioLiP]