Structure of PDB 1f58 Chain H Binding Site BS01

Receptor Information
>1f58 Chain H (length=228) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLQQSGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMG
YIHYSAGTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAREE
AMPYGNQAYYYAMDCWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVT
LGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSP
RPSETVTCNVAHPASSTKVDKKIVPRDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f58 Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
Y50 H52 N58 E95 Y100 A100D Y100E Y100G
Binding residue
(residue number reindexed from 1)
Y51 H53 N59 E99 Y104 A108 Y109 Y111
Enzymatic activity
Enzyme Commision number ?
External links