Structure of PDB 1ejo Chain H Binding Site BS01

Receptor Information
>1ejo Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMLVESGGDLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATI
SSGGAYTYYPDSVKGRFTISDDNAESTLYLQMSSLRSEDTAMYYCVRRAF
DSDVGFASWGHRTLVTVSAAKTTAPSVYPLAPVCGSVTLGCLVKGYFPEP
VTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAH
PASSTKVDKKIEPR
Ligand information
>1ejo Chain P (length=13) Species: 12121 (Foot-and-mouth disease virus C1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YTTSTRGDLAHVT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ejo A multiply substituted G-H loop from foot-and-mouth disease virus in complex with a neutralizing antibody: a role for water molecules.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T2532 T2549 S2551 Y2556 Y2558 R2598 S2602 D2603
Binding residue
(residue number reindexed from 1)		T32 T49 S51 Y56 Y58 R98 S102 D103
Enzymatic activity
Enzyme Commision number ?
External links