Structure of PDB 1ea4 Chain H Binding Site BS01

Receptor Information

>1ea4 Chain H (length=44) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQEK

Ligand information

>1ea4 Chain U (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaccgtgcactcaatgcaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ea4 Plasmid Transcriptional Repressor Copg Oligomerises to Render Helical Superstructures Unbound and in Complexes with Oligonucleotides
Resolution	2.95 Å
Binding residue (original residue number in PDB)	R4 L5 T6 T8
Binding residue (residue number reindexed from 1)	R3 L4 T5 T7

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006276	plasmid maintenance
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ea4, PDBe:1ea4, PDBj:1ea4
PDBsum	1ea4
PubMed	11428897
UniProt	P13920\|COPG_STRAG Protein CopG (Gene Name=copG)

[Back to BioLiP]