Structure of PDB 1d9k Chain H Binding Site BS01

Receptor Information
>1d9k Chain H (length=188) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSERHFVHQFQPFCYFTNGTQRIRLVIRYIYNREEYVRFDSDVGEYRAVT
ELGRPDAEYWNKQYLERTRAELDTVCRHNYEKTETPTSLRRLEQPSVVIS
LSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGD
WTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d9k The crystal structure of a T cell receptor in complex with peptide and MHC class II.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F11 Y30 Y47 P56 D57 Y60 W61 Y67 E74 T77 V78 H81 N82
Binding residue
(residue number reindexed from 1)		F10 Y29 Y46 P55 D56 Y59 W60 Y64 E71 T74 V75 H78 N79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1d9k, PDBe:1d9k, PDBj:1d9k
PDBsum1d9k
PubMed10583947
UniProtP06343|HB2K_MOUSE H-2 class II histocompatibility antigen, A-K beta chain (Gene Name=H2-Ab1)

[Back to BioLiP]