Structure of PDB 1cu4 Chain H Binding Site BS01

Receptor Information
>1cu4 Chain H (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLQQSGAELVRSGASVKLSCTASGFNIKDYYIQWVKQRPEQGLEWIGWID
PENGNSEYAPRFQGKATMTADTLSNTAYLQLSSLTSEDTAVYYCNADLHD
YWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVT
LTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPA
SSTKVDKKIEPRVTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cu4 Antibody binding defines a structure for an epitope that participates in the PrPC-->PrPSc conformational change.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D31 Y33 W50 D52 E53 E58 D95 L96
Binding residue
(residue number reindexed from 1)		D29 Y31 W48 D50 E52 E57 D97 L98
External links