Structure of PDB 1abi Chain H Binding Site BS01

Receptor Information
>1abi Chain H (length=252) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
GE
Ligand information
>1abi Chain I (length=20) Species: 6421 (Hirudo medicinalis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FPRGGGGGNGDFEEIPEEYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1abi Structure of the hirulog 3-thrombin complex and nature of the S' subsites of substrates and inhibitors.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F34 Q38 E39 L40 L41 H57 Y60A K60F R73 T74 R75 Y76 K81 I82 M84 N98 L99 Q151 I174 D189 C191 E192 G193 S195 W215 G216 G219
Binding residue
(residue number reindexed from 1)		F19 Q24 E25 L26 L27 H43 Y47 K52 R68 T69 R70 Y71 K77 I78 M80 N95 L96 Q149 I172 D192 C194 E195 G196 S198 W220 G221 G223
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1abi, PDBe:1abi, PDBj:1abi
PDBsum1abi
PubMed1445905
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]