Structure of PDB 4v8p Chain GR Binding Site BS01

Receptor Information

>4v8p Chain GR (length=121) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KTYTGVRFFRPKTLQLAKAPKYSRTVRAHLKVSGHLDNHSVVKTPLTTEK
AMKKMEDENTMVFYVHNRSTKPQIKSAFEKLYNVKVRSVNTLNTITGNKK
AYIRLAADSDSLTLANKIGLI

Ligand information

>4v8p Chain G2 (length=154) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agaaaauuuucaacgguggauaucuagguucccgugacgaugaagaacgc
agcgaaaugcgauacgcaaugcgaauugcagaaccgcgagucaucagauc
uuugaacgcaagugguggagguguaaaaaccuucauguuuguuucagugu
ggaa

............................................<<<<<<
.<<.....>>>.....(.<<<......>>............>>>..)...
>>>....<<.....>><<<<<<......>>>>>>................
....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
Resolution	3.52 Å
Binding residue (original residue number in PDB)	P40 L43 K47 R56 H64 T99 P101
Binding residue (residue number reindexed from 1)	P11 L14 K18 R27 H35 T70 P72

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	P0DJ57\|RL23A_TETTS Large ribosomal subunit protein uL23 (Gene Name=RPL23A)

[Back to BioLiP]