BioLiP

Receptor Information

>4v8p Chain GM (length=300) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GFVKVLKTKAYFKRFQTKYRRRREGLTDYYARKRLIIQDKDKYNTPKYRL
VARATNTRIIAQIVYATLKCDRVLCAADSYELKRFGVSTGLASYAAAYAT
GLLLARRLLKQIGLDTVYAGQTKVDGAYFNVDEDQKEKKPFKAILDAGLV
RTTTGNRVFGVLKGACDGGINIPHSESRFPGYVRASDEGESSKYKPEDHK
ARIFGKHIDAYMKHLKGQSNEAFQKQFSKWSKTLEAAKVDSVEKLFTKVH
AEIRKNPERVKSTKKNDKPKRDHKKFYPTKLTAAQRKDRVKTKFQLALSQ

>4v8p Chain G3 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guugucggccauacuaaggugaaaacaccggaucccauucgaacuccgaa
guuaagcgccuuaaggcuggguuaguacuaaggugggggaccgcuuggga
agucccagugucgauagccu

<<<<<<<<.....<<<<<<<......<<<<<<............>>>>..
>>.....>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>.>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
Resolution	3.52 Å
Binding residue (original residue number in PDB)	F13 K14 T18 Y20 R21 R22 R24 T28 R33 R50 R54 T56 N57 T58 I61 Q63 L69 K70 C71 D72 R73 V74 Y81 T90 G91 S94 Y95 R152 T154 T155 N157 R158 R203 H208 I209 Y212 H215 K226 Q227 F228 S229 K230 R260 K265 N267 P270 H274 K275 F277 Y278 P279 K281 L282 R287 R290
Binding residue (residue number reindexed from 1)	F12 K13 T17 Y19 R20 R21 R23 T27 R32 R49 R53 T55 N56 T57 I60 Q62 L68 K69 C70 D71 R72 V73 Y80 T89 G90 S93 Y94 R151 T153 T154 N156 R157 R202 H207 I208 Y211 H214 K225 Q226 F227 S228 K229 R259 K264 N266 P269 H273 K274 F276 Y277 P278 K280 L281 R286 R289

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	Q231U7\|RL5_TETTS Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]

Structure of PDB 4v8p Chain GM Binding Site BS01