Structure of PDB 4v8p Chain GH Binding Site BS01

Receptor Information

>4v8p Chain GH (length=201) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRRPARCYRQPKGKPYPKSRYNRGVPDARIRIYDSGRKKATVEEFPYVVH
IVSDEKEQITSEALEAARIAANKNLIKFISKDAFHLRCRVHPWHVLRINK
SGMRGAFGKALGKAARVDIGSILFSVRVKEPHVKYAIDALTRAKAKFPGR
QKVVTSQKWGFTKLTRAQYSRLRNQKKLVTDGSNVKVIGERGPLSRLELF
R

Ligand information

>4v8p Chain G3 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guugucggccauacuaaggugaaaacaccggaucccauucgaacuccgaa
guuaagcgccuuaaggcuggguuaguacuaaggugggggaccgcuuggga
agucccagugucgauagccu

<<<<<<<<.....<<<<<<<......<<<<<<............>>>>..
>>.....>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>.>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
Resolution	3.52 Å
Binding residue (original residue number in PDB)	E56 K57 R162 E202 R203 G204 P205 L206 L209
Binding residue (residue number reindexed from 1)	E55 K56 R150 E190 R191 G192 P193 L194 L197

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	Q235M8\|RL10_TETTS Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]