Structure of PDB 8q3e Chain GGG Binding Site BS01

Receptor Information
>8q3e Chain GGG (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
AVLLPKK
Ligand information
>8q3e Chain MMM (length=17) Species: 11963 (Human spumaretrovirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGYNLRPRTYQPQRYGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q3e Viral peptide conjugates for metal-warhead delivery to chromatin.
Resolution2.174 Å
Binding residue
(original residue number in PDB)		E56 Y57 A60 E61 E64 R88 N89 D90 E91 E92 L108 N110 Q112
Binding residue
(residue number reindexed from 1)		E44 Y45 A48 E49 E52 R76 N77 D78 E79 E80 L96 N98 Q100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3e, PDBe:8q3e, PDBj:8q3e
PDBsum8q3e
PubMed38495982
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]