Structure of PDB 7uio Chain GA Binding Site BS01

Receptor Information
>7uio Chain GA (length=89) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K17 K18 L49 T50 R51
Binding residue
(residue number reindexed from 1)		K10 K11 L42 T43 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uio, PDBe:7uio, PDBj:7uio
PDBsum7uio
PubMed36731470
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]