Structure of PDB 9c4c Chain G Binding Site BS01

Receptor Information
>9c4c Chain G (length=135) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYL
IYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIE
HHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c4c The structure of two MntR dimers bound to the native mnep promoter sequence.
Resolution3.09 Å
Binding residue
(original residue number in PDB)
R24 S26 S37 T40 K41 Y54 Y57
Binding residue
(residue number reindexed from 1)
R22 S24 S35 T38 K39 Y52 Y55
External links
PDB RCSB:9c4c, PDBe:9c4c, PDBj:9c4c
PDBsum9c4c
PubMed
UniProtP54512|MNTR_BACSU HTH-type transcriptional regulator MntR (Gene Name=mntR)

[Back to BioLiP]