Structure of PDB 8zv9 Chain G Binding Site BS01

Receptor Information
>8zv9 Chain G (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPR
APWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMM
FGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWE
AAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVV
VPSGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
>8zv9 Chain I (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYNYLFRLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zv9 Structural insights into immune escape at killer T cell epitope by SARS-CoV-2 Spike Y453F variants.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 T73 E76 N77 I80 L95 M97 F99 Y116 Y123 T143 K146 W147 Q155 Q156 Y159 T163 R170 Y171
Binding residue
(residue number reindexed from 1)		Y9 E65 K68 V69 H72 T75 E78 N79 I82 L97 M99 F101 Y118 Y125 T145 K148 W149 Q157 Q158 Y161 T165 R172 Y173
External links