Structure of PDB 8ybk Chain G Binding Site BS01

Receptor Information
>8ybk Chain G (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVL
Ligand information
>8ybk Chain I (length=114) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacg
cacgtacgcgctgtcccccgcgttttaaccgccaaggggattactcccta
gtctccaggcacgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ybk Cryo-EM structure and biochemical analyses of the nucleosome containing the cancer-associated histone H3 mutation E97K.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		R11 R42 V43 A45
Binding residue
(residue number reindexed from 1)		R3 R34 V35 A37
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ybk, PDBe:8ybk, PDBj:8ybk
PDBsum8ybk
PubMed38972377
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]