Structure of PDB 8y2h Chain G Binding Site BS01

Receptor Information
>8y2h Chain G (length=267) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFE
VILVSSGAVGLGRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLM
AYYETMFDQLDVTAAQLLVNDSSFRDKDFRKQLNETVKSMLDLRVIPIFN
ENDAISTRSSGIFWDNDSLAALLALELKADLLILLSDVEGLYTGPPSDPN
SKLIHTFVKEKHQDEITFGMTAKVKAAVNAAYAGIPVIITSGYSAENIDK
VLRGLRVGTLFHQDARL
Ligand information
>8y2h Chain D (length=15) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YRQLVNSSFADLQKP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8y2h Dynamic Arabidopsis P5CS filament facilitates substrate channelling.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
V76 S78 S79 F80
Binding residue
(residue number reindexed from 1)
V72 S74 S75 F76
Enzymatic activity
Enzyme Commision number 1.2.1.41: glutamate-5-semialdehyde dehydrogenase.
2.7.2.11: glutamate 5-kinase.
Gene Ontology
Molecular Function
GO:0004349 glutamate 5-kinase activity
GO:0004350 glutamate-5-semialdehyde dehydrogenase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016491 oxidoreductase activity
GO:0017084 delta1-pyrroline-5-carboxylate synthetase activity
Biological Process
GO:0006561 proline biosynthetic process
GO:0006979 response to oxidative stress
GO:0009084 glutamine family amino acid biosynthetic process
GO:0009414 response to water deprivation
GO:0009555 pollen development
GO:0009651 response to salt stress
GO:0016310 phosphorylation
GO:0042538 hyperosmotic salinity response
GO:0048364 root development
GO:0055129 L-proline biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0009507 chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8y2h, PDBe:8y2h, PDBj:8y2h
PDBsum8y2h
PubMed38740943
UniProtP54887|P5CS1_ARATH Delta-1-pyrroline-5-carboxylate synthase A (Gene Name=P5CSA)

[Back to BioLiP]