Structure of PDB 8x5d Chain G Binding Site BS01

Receptor Information
>8x5d Chain G (length=77) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITGTLTVLTGLQIGAKPVVPMIPGTSLKGKVLTEVKFENAINRVTAKANL
RQMERVIPGSEDYLGGSGTRGYGQVKF
Ligand information
>8x5d Chain O (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaacuuaaaaccguguugcacugcaacccggaauucuugcacgucg
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x5d Mycobacterium tuberculosis type III-A CRISPR/Cas system crRNA and its maturation have atypical features.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		G23 K55 G56 F125 E126 N127 I129 L138 R139 G198 S199 T201 R202
Binding residue
(residue number reindexed from 1)		G14 K28 G29 F37 E38 N39 I41 L50 R51 G66 S67 T69 R70
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8x5d, PDBe:8x5d, PDBj:8x5d
PDBsum8x5d
PubMed38218299
UniProtP9WJF9|CSM3_MYCTU CRISPR system Cms endoribonuclease Csm3 (Gene Name=csm3)

[Back to BioLiP]