Structure of PDB 8v7l Chain G Binding Site BS01

Receptor Information
>8v7l Chain G (length=102) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPN
IQ
Ligand information
>8v7l Chain I (length=140) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtatatatctgacacgtgcctggagactagggagtaatccccttggcggt
taaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgt
ctacgaccaattgagcggcctcggcaccgggattctccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v7l Functionalized graphene-oxide grids enable high-resolution cryo-EM structures of the SNF2h-nucleosome complex without crosslinking.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R11 K15 R17 R20 R32 R77
Binding residue
(residue number reindexed from 1)		R1 K5 R7 R10 R22 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8v7l, PDBe:8v7l, PDBj:8v7l
PDBsum8v7l
PubMed38472177
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]