Structure of PDB 8urw Chain G Binding Site BS01

Receptor Information
>8urw Chain G (length=120) Species: 32046 (Synechococcus elongatus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKARWYAVQVASGCEKRVKATLEQRVQTLDAANRILQVEIPETPIVKLKK
DGSRQSAEEKVFPGYVLVRMILDDDAWQIVRNTPHVINFVGAEQKRPYGR
GRGHVKPMPLSPGEVGRIFK
Ligand information
>8urw Chain N (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcgcatgctgctctaggagaggtacacggcgactgccc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8urw Cryo-EM structure of a cyanobacterial RNAP elongation complex with NusG and CTP.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		A29 S30 I105
Binding residue
(residue number reindexed from 1)		A11 S12 I87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8urw, PDBe:8urw, PDBj:8urw
PDBsum8urw
PubMed38354263
UniProtQ31QK2

[Back to BioLiP]