Structure of PDB 8u77 Chain G Binding Site BS01

Receptor Information
>8u77 Chain G (length=68) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLY
SLPEGLLKSLWDYVKKNT
Ligand information
>8u77 Chain F (length=10) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPKLLLKINL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u77 Molecular insight into interactions between the Taf14, Yng1 and Sas3 subunits of the NuA3 complex.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		T187 L194
Binding residue
(residue number reindexed from 1)		T12 L19
External links
PDB RCSB:8u77, PDBe:8u77, PDBj:8u77
PDBsum8u77
PubMed38914563
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]