Structure of PDB 8trr Chain G Binding Site BS01

Receptor Information
>8trr Chain G (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTV
YPAKTLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTL
VMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8trr T cell recognition of citrullinated alpha-enolase peptide presented by HLA-DR4
Resolution2.65 Å
Binding residue
(original residue number in PDB)
E9 H13 Y30 Y37 D57 Y60 W61 K71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
E8 H12 Y29 Y36 D56 Y59 W60 K70 Y77 H80 N81 V84
External links
PDB RCSB:8trr, PDBe:8trr, PDBj:8trr
PDBsum8trr
PubMed39043656
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]