Structure of PDB 8syi Chain G Binding Site BS01

Receptor Information
>8syi Chain G (length=120) Species: 32046 (Synechococcus elongatus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKARWYAVQVASGCEKRVKATLEQRVQTLDAANRILQVEIPETPIVKLKK
DGSRQSAEEKVFPGYVLVRMILDDDAWQIVRNTPHVINFVGAEQKRPYGR
GRGHVKPMPLSPGEVGRIFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8syi Cryo-EM structure of a cyanobacterial RNAP elongation complex
Resolution2.94 Å
Binding residue
(original residue number in PDB)		A29 I105 R120
Binding residue
(residue number reindexed from 1)		A11 I87 R102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8syi, PDBe:8syi, PDBj:8syi
PDBsum8syi
PubMed38354263
UniProtQ31QK2

[Back to BioLiP]