Structure of PDB 8sm5 Chain G Binding Site BS01

Receptor Information

>8sm5 Chain G (length=155) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYH
VLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRA
LAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWS
TLIED

Ligand information

>8sm5 Chain D (length=17) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DIIRNIARHLAQVGDSM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8sm5 Epstein-Barr Virus Encoded BCL2, BHRF1, Downregulates Autophagy by Noncanonical Binding of BECN1.
Resolution	2.61003 Å
Binding residue (original residue number in PDB)	R18 R34
Binding residue (residue number reindexed from 1)	R17 R33

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0042981	regulation of apoptotic process

View graph for
Biological Process

External links

PDB	RCSB:8sm5, PDBe:8sm5, PDBj:8sm5
PDBsum	8sm5
PubMed	37776275
UniProt	P03182\|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]