Structure of PDB 8skj Chain G Binding Site BS01

Receptor Information
>8skj Chain G (length=119) Species: 9835 (Camelidae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQASGGGFVQPGGSLRLSCAASGTTSFGDTMGWFRQAPGKEREFVSAI
SRDDSHYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAEWMNT
RREFITPYWGQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8skj Development of a V5-tag-directed nanobody and its implementation as an intracellular biosensor of GPCR signaling.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		R47 F49 H61 Y62 R107 E108 F109 I110 P112
Binding residue
(residue number reindexed from 1)		R44 F46 H56 Y57 R102 E103 F104 I105 P107
External links