Structure of PDB 8rkg Chain G Binding Site BS01

Receptor Information
>8rkg Chain G (length=170) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFN
LENQRLYVADLRLVSQFGSPRISIDTPMICARDSPSCNSTHATVLIPFFG
GVLTGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRSTLKGDRNDVL
VLTFIYYGKTVPMLISLVCS
Ligand information
>8rkg Chain R (length=25) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVVTCTKDSMTVRIPRTLSGFDDEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D195 P196 Y197 Y198 L199 T200 V201 Q202 A203 Y205 T240 M242 I243 C244 R246 P326 M327 L328
Binding residue
(residue number reindexed from 1)		D31 P32 Y33 Y34 L35 T36 V37 Q38 A39 Y41 T76 M78 I79 C80 R82 P162 M163 L164
Enzymatic activity
Enzyme Commision number ?
External links