Structure of PDB 8qpp Chain G Binding Site BS01

Receptor Information
>8qpp Chain G (length=149) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYKSFDIIKER
TGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRW
LVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFA
Ligand information
>8qpp Chain V (length=33) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaccaaugccauguacgucgcacucggaagac
.................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
Resolution3.4 Å
Binding residue
(original residue number in PDB)
R79 G81
Binding residue
(residue number reindexed from 1)
R76 G78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
PDBsum8qpp
PubMed38177497
UniProtA0A063X741

[Back to BioLiP]