Structure of PDB 8qbl Chain G Binding Site BS01

Receptor Information
>8qbl Chain G (length=124) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKFTDEQQQQLIGHLTKKGFYRERFLLPCIYLLDSVNYRTLCELAFKAIK
QDDVLSKIIVRSVVSRLINERKILQMTDGYQVTALGASYVRSVFDRKTLD
RLRLEIMNFENRRKSTFNYDKIPY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qbl Retron-Eco1 assembles NAD + -hydrolyzing filaments that provide immunity against bacteriophages.
Resolution2.66 Å
Binding residue
(original residue number in PDB)		S295 Y304
Binding residue
(residue number reindexed from 1)		S115 Y124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Biological Process
External links
PDB RCSB:8qbl, PDBe:8qbl, PDBj:8qbl
PDBsum8qbl
PubMed38788717
UniProtP0DV88|RIB86_ECOLX Retron Ec86 putative ribosyltransferase/DNA-binding protein (Gene Name=LM2_00875)

[Back to BioLiP]