Structure of PDB 8qbk Chain G Binding Site BS01

Receptor Information
>8qbk Chain G (length=133) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKFTDEQQQQLIGHLTKKGFYRGDIGNILYAERFLLPCIYLLDSVNYRTL
CELAFKAIKQDDVLSKIIVRSVVSRLINERKILQMTDGYQVTALGASYVR
SVFDRKTLDRLRLEIMNFENRRKSTFNYDKIPY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qbk Retron-Eco1 assembles NAD + -hydrolyzing filaments that provide immunity against bacteriophages.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		R276 K277 R281 S295 T296 Y304
Binding residue
(residue number reindexed from 1)		R105 K106 R110 S124 T125 Y133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Biological Process
External links
PDB RCSB:8qbk, PDBe:8qbk, PDBj:8qbk
PDBsum8qbk
PubMed38788717
UniProtP0DV88|RIB86_ECOLX Retron Ec86 putative ribosyltransferase/DNA-binding protein (Gene Name=LM2_00875)

[Back to BioLiP]