Structure of PDB 8pmv Chain G Binding Site BS01

Receptor Information
>8pmv Chain G (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWY
QNRRTKWKRQTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pmv transcription factor BARHL2 bound to DNA sequences
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R233 K234 R236 T237 F239 N282 K286
Binding residue
(residue number reindexed from 1)		R3 K4 R6 T7 F9 N52 K56
External links
PDB RCSB:8pmv, PDBe:8pmv, PDBj:8pmv
PDBsum8pmv
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]