Structure of PDB 8ouf Chain G Binding Site BS01

Receptor Information
>8ouf Chain G (length=353) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFI
NLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRL
VKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKR
QLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQ
MQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKL
LTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEA
ICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLM
IKQ
Ligand information
>8ouf Chain B (length=86) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccugcggcggccgcaggaagaggaacggagcgagucccgggcgcgucccu
gagcugugggacgugcccaggacucgcucacacaug
<<<<<<<<.>>>>>>>>..........<<<<<<<<<<.<<<<<<<<<<<.
.......>>>>>>>>>>>.>>>>>>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ouf 2.7 angstrom cryo-EM structure of human telomerase H/ACA ribonucleoprotein.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		H68 N99 E104 R111 R141 K302 S304 A305 Y311 G312 A313 K314 M316 P318 G319 D359 H360 G361 R368 V369 R373 R378 K379 W380 G381 L382 G383 P384 K385 A386
Binding residue
(residue number reindexed from 1)		H26 N57 E62 R69 R99 K260 S262 A263 Y269 G270 A271 K272 M274 P276 G277 D317 H318 G319 R326 V327 R331 R336 K337 W338 G339 L340 G341 P342 K343 A344
Enzymatic activity
Enzyme Commision number 5.4.99.-
Gene Ontology
Molecular Function
GO:0003720 telomerase activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0034513 box H/ACA snoRNA binding
GO:0070034 telomerase RNA binding
Biological Process
GO:0000455 enzyme-directed rRNA pseudouridine synthesis
GO:0000495 box H/ACA sno(s)RNA 3'-end processing
GO:0001522 pseudouridine synthesis
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0007004 telomere maintenance via telomerase
GO:0009451 RNA modification
GO:0031118 rRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0033979 box H/ACA sno(s)RNA metabolic process
GO:0042254 ribosome biogenesis
GO:0090666 scaRNA localization to Cajal body
GO:0090669 telomerase RNA stabilization
GO:1904867 protein localization to Cajal body
GO:1904872 regulation of telomerase RNA localization to Cajal body
GO:1904874 positive regulation of telomerase RNA localization to Cajal body
GO:1990481 mRNA pseudouridine synthesis
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0015030 Cajal body
GO:0031429 box H/ACA snoRNP complex
GO:0072589 box H/ACA scaRNP complex
GO:0090661 box H/ACA telomerase RNP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ouf, PDBe:8ouf, PDBj:8ouf
PDBsum8ouf
PubMed38272871
UniProtO60832|DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 (Gene Name=DKC1)

[Back to BioLiP]