Structure of PDB 8ots Chain G Binding Site BS01

Receptor Information

>8ots Chain G (length=109) Species: 9606 (Homo sapiens)

KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVL
PNIQAVLLP

Ligand information

>8ots Chain I (length=127)

ctttgttatgcaaatcggggtggggcgtcgtagacagctctagcaccgct
taaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattac
tccctagtctccaggcacgtgtcagat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ots Cooperation between bHLH transcription factors and histones for DNA access.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): R42 V43 A45
• Binding residue (residue number reindexed from 1): R34 V35 A37

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8ots, PDBe:8ots, PDBj:8ots
• PDBsum: 8ots
• PubMed: 37407816
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)