Structure of PDB 8onk Chain G Binding Site BS01

Receptor Information
>8onk Chain G (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSMHWVKQAPGKGLKWIGW
INTETGAPTYADDFKGRFALSLETSASSAFLQINNLKNEDTATYFCASGI
RHAMDYWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVPR
Ligand information
>8onk Chain I (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8onk Macromolecular structure of insulin and IgE clonality impacts IgE-mediated activation of sensitized basophils
Resolution3.403 Å
Binding residue
(original residue number in PDB)		D31 Y32 W50 N52 T52A E53 T54 A56 T58
Binding residue
(residue number reindexed from 1)		D31 Y32 W50 N52 T53 E54 T55 A57 T59
External links