Structure of PDB 8oki Chain G Binding Site BS01

Receptor Information
>8oki Chain G (length=81) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNK
GVVDEAIRGIRHARGVLPGEVPFKEIEHFLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oki Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment
Resolution3.45 Å
Binding residue
(original residue number in PDB)		T11 H12 R67
Binding residue
(residue number reindexed from 1)		T8 H9 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0003746 translation elongation factor activity
GO:0005515 protein binding
Biological Process
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006412 translation
GO:0006414 translational elongation
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oki, PDBe:8oki, PDBj:8oki
PDBsum8oki
PubMed38709902
UniProtQ8TZK1|SPT5_PYRFU Transcription elongation factor Spt5 (Gene Name=spt5)

[Back to BioLiP]